PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco003738.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family WRKY
Protein Properties Length: 605aa    MW: 64257.2 Da    PI: 6.3471
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco003738.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.11.1e-30264321260
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                  +DgynWrKYGqK+vkg e+prsYY+Ct+++Cp+kk++ers+ d++++e++Y +eH+h+k
  Aco003738.1 264 EDGYNWRKYGQKHVKGCENPRSYYKCTHPNCPAKKHIERSN-DGQITETIYISEHDHPK 321
                  8****************************************.***************85 PP

2WRKY106.81.1e-33424482159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+v+g+++prsYY+Ct++gCpv+k+ver+++dp++v++tYeg+Hnh+
  Aco003738.1 424 LDDGYRWRKYGQKVVRGNPNPRSYYKCTFNGCPVRKHVERASHDPRAVITTYEGKHNHD 482
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.606258322IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.5E-27259322IPR003657WRKY domain
SuperFamilySSF1182901.57E-24262322IPR003657WRKY domain
SMARTSM007743.4E-35263321IPR003657WRKY domain
PfamPF031067.3E-24264320IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.6E-37409484IPR003657WRKY domain
SuperFamilySSF1182901.44E-29416484IPR003657WRKY domain
PROSITE profilePS5081138.343419484IPR003657WRKY domain
SMARTSM007743.3E-39424483IPR003657WRKY domain
PfamPF031063.8E-26425482IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MEESTDAGDL AGGGRAPLPE PRSGGLGAGS GVGGGRARDG RSPPLAGDIA GGGGPPAPEP  60
RSRGLGAGSG GGAPERRGPP LAGARYRSMS PAQLPIPRAP CLTIPPGLSP SALLESPVEP  120
SPTTGTLTMP YIMNRTVQAD ALSSSRETSI NSAYNNGSSG DFEFKPHARS YLHTSVPTLR  180
ASGSANANLQ EHEPFVQTQI QANNPYNHAV TAHNEAFTTQ ESTLSIISRT SPTQPVECSE  240
ENITELRSDP GGPNPSSVVE KSAEDGYNWR KYGQKHVKGC ENPRSYYKCT HPNCPAKKHI  300
ERSNDGQITE TIYISEHDHP KPQPNRRSAV GALLSSQGVD KPDCLLSAEV NPIGTTELSS  360
GSASEDDVDG GGGRSNTGDE IAADGDLEAK RRKLDAPNFD ATAINRPNRE PRVVVQTISE  420
VDILDDGYRW RKYGQKVVRG NPNPRSYYKC TFNGCPVRKH VERASHDPRA VITTYEGKHN  480
HDVPASRTNG HGVSASMTTT SVQNPTNNQF TQPEESDTIS LDLGVGFSPN HNSPADEAQS  540
LGIDQTPHHQ MPSDSSIHAS QVSALYRSGS IYGYIEDKNE GFTFKTAPVS HSSNLYSGNS  600
VLDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-36264485878Probable WRKY transcription factor 4
2lex_A1e-36264485878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009396393.10.0PREDICTED: probable WRKY transcription factor 20 isoform X1
RefseqXP_009396395.10.0PREDICTED: probable WRKY transcription factor 20 isoform X3
SwissprotQ6VWJ61e-163WRK46_HORVU; WRKY transcription factor SUSIBA2
TrEMBLM0SNR20.0M0SNR2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P13970_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67403851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-120WRKY family protein